TMEM63C anticorps (Middle Region)

N° du produit ABIN635467

Détail du produit anti-TMEM63C anticorps

Antigène: TMEM63C (Transmembrane Protein 63C (TMEM63C))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM63C est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM63 C antibody was raised against the middle region of TMEM63

Purification: Affinity purified

Immunogène: TMEM63 C antibody was raised using the middle region of TMEM63 corresponding to a region with amino acids EEEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPASSPARHTYGTM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM63C Blocking Peptide, catalog no. 33R-2348, is also available for use as a blocking control in assays to test for specificity of this TMEM63C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM60 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM63C

Antigène: TMEM63C (Transmembrane Protein 63C (TMEM63C))

Autre désignation: TMEM63C (TMEM63C Produits)

Synonymes: anticorps DKFZp468A1211, anticorps C14orf171, anticorps 4932420N09, anticorps 9330187M14Rik, anticorps RGD1310207, anticorps transmembrane protein 63C, anticorps transmembrane protein 63c, anticorps TMEM63C, anticorps tmem63c, anticorps Tmem63c

Sujet: The function of TMEM63C protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 93 kDa (MW of target protein)