GALNTL1 anticorps (N-Term)

N° du produit ABIN635472

Détail du produit anti-GALNTL1 anticorps

Antigène: GALNTL1 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase-Like 1 (GALNTL1))

Épitope: N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GALNTL1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GALNTL1 antibody was raised against the N terminal Of Galntl1

Purification: Affinity purified

Immunogène: GALNTL1 antibody was raised using the N terminal Of Galntl1 corresponding to a region with amino acids LSAKQLKAGEDPYRQHAFNQLESDKLSPDRPIRDTRHYSCPSVSYSSDLP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GALNTL1 Blocking Peptide, catalog no. 33R-5407, is also available for use as a blocking control in assays to test for specificity of this GALNTL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNTL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GALNTL1

Antigène: GALNTL1 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase-Like 1 (GALNTL1))

Autre désignation: GALNTL1 (GALNTL1 Produits)

Synonymes: anticorps galntl1, anticorps xGalntl-1, anticorps GALNACT16, anticorps GALNTL1, anticorps GalNAc-T16, anticorps 5730405L21Rik, anticorps AI415388, anticorps Galntl1, anticorps mpp-GalNAc-T16, anticorps polypeptide N-acetylgalactosaminyltransferase 16, anticorps UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 16, anticorps polypeptide N-acetylgalactosaminyltransferase 16 L homeolog, anticorps GALNT16, anticorps galnt16, anticorps galnt16.L, anticorps Galnt16

Sujet: GALNTL1 belongs to the glycosyltransferase 2 family, GalNAc-T subfamily. It contains 1 ricin B-type lectin domain. GALNTL1 may catalyze the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.

Poids moléculaire: 63 kDa (MW of target protein)