TMCC3 anticorps (N-Term)

N° du produit ABIN635473

Cet anticorps Lapin Polyclonal détecte spécifiquement TMCC3 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour TMCC3 anticorps (N-Term) (ABIN635473)

Antigène: TMCC3 (Transmembrane and Coiled-Coil Domain Family 3 (TMCC3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMCC3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMCC3 anticorps

Épitope: N-Term

Specificité: TMCC3 antibody was raised against the N terminal of TMCC3

Purification: Affinity purified

Immunogène: TMCC3 antibody was raised using the N terminal of TMCC3 corresponding to a region with amino acids MPGSDTALTVDRTYSDPGRHHRCKSRVERHDMNTLSLPLNIRRGGSDTNL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMCC3 Blocking Peptide, (ABIN5616648), is also available for use as a blocking control in assays to test for specificity of this TMCC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMCC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMCC3

Antigène: TMCC3 (Transmembrane and Coiled-Coil Domain Family 3 (TMCC3))

Autre désignation: TMCC3

Sujet: The function of TMCC3 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 54 kDa (MW of target protein)