TMCC3 anticorps (N-Term)

N° du produit ABIN635473

Détail du produit anti-TMCC3 anticorps

Antigène: TMCC3 (Transmembrane and Coiled-Coil Domain Family 3 (TMCC3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMCC3 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMCC3 antibody was raised against the N terminal of TMCC3

Purification: Affinity purified

Immunogène: TMCC3 antibody was raised using the N terminal of TMCC3 corresponding to a region with amino acids MPGSDTALTVDRTYSDPGRHHRCKSRVERHDMNTLSLPLNIRRGGSDTNL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMCC3 Blocking Peptide, catalog no. 33R-6283, is also available for use as a blocking control in assays to test for specificity of this TMCC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMCC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMCC3

Antigène: TMCC3 (Transmembrane and Coiled-Coil Domain Family 3 (TMCC3))

Autre désignation: TMCC3 (TMCC3 Produits)

Synonymes: anticorps wu:fb81d10, anticorps wu:fb83h01, anticorps wu:fk68a09, anticorps wu:fl22e07, anticorps si:dkey-183c16.4, anticorps DKFZp469H0211, anticorps AW488095, anticorps C630016B22Rik, anticorps C88213, anticorps Tmcc1, anticorps RGD1307241, anticorps transmembrane and coiled-coil domain family 3, anticorps transmembrane and coiled coil domains 3, anticorps tmcc3, anticorps TMCC3, anticorps Tmcc3

Sujet: The function of TMCC3 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 54 kDa (MW of target protein)