CACHD1 anticorps (N-Term)

N° du produit ABIN635475

Cet anticorps anti-CACHD1 est un anticorps Lapin Polyclonal détectant CACHD1 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour CACHD1 anticorps (N-Term) (ABIN635475)

Antigène: CACHD1 (Cache Domain Containing 1 (CACHD1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CACHD1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CACHD1 anticorps

Épitope: N-Term

Specificité: CACHD1 antibody was raised against the N terminal of CACHD1

Purification: Affinity purified

Immunogène: CACHD1 antibody was raised using the N terminal of CACHD1 corresponding to a region with amino acids HKFRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQLQIAKDAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CACHD1 Blocking Peptide, (ABIN939147), is also available for use as a blocking control in assays to test for specificity of this CACHD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACHD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CACHD1

Antigène: CACHD1 (Cache Domain Containing 1 (CACHD1))

Autre désignation: CACHD1

Sujet: CACHD1 belongs to the calcium channel subunit alpha-2/delta family. It contains 2 cache domains and 1 VWFA domain. CACHD1 may regulate voltage-dependent calcium channels.

Poids moléculaire: 137 kDa (MW of target protein)