CACHD1 anticorps (N-Term)
-
- Antigène Voir toutes CACHD1 Anticorps
- CACHD1 (Cache Domain Containing 1 (CACHD1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CACHD1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CACHD1 antibody was raised against the N terminal of CACHD1
- Purification
- Affinity purified
- Immunogène
- CACHD1 antibody was raised using the N terminal of CACHD1 corresponding to a region with amino acids HKFRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQLQIAKDAA
- Top Product
- Discover our top product CACHD1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CACHD1 Blocking Peptide, catalog no. 33R-3761, is also available for use as a blocking control in assays to test for specificity of this CACHD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACHD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CACHD1 (Cache Domain Containing 1 (CACHD1))
- Autre désignation
- CACHD1 (CACHD1 Produits)
- Synonymes
- anticorps CACHD1, anticorps RP4-655E10.1, anticorps 1190007F10Rik, anticorps AI852726, anticorps B430218L07Rik, anticorps Vwcd1, anticorps mKIAA1573, anticorps RGD1310770, anticorps cache domain containing 1, anticorps VWFA and cache domain-containing protein 1, anticorps CACHD1, anticorps LOC593655, anticorps cachd1, anticorps Cachd1
- Sujet
- CACHD1 belongs to the calcium channel subunit alpha-2/delta family. It contains 2 cache domains and 1 VWFA domain. CACHD1 may regulate voltage-dependent calcium channels.
- Poids moléculaire
- 137 kDa (MW of target protein)
-