CATSPERG anticorps (C-Term)

N° du produit ABIN635477

Détail du produit anti-CATSPERG anticorps

Antigène: CATSPERG (Cation Channel, Sperm-Associated, gamma (CATSPERG))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CATSPERG est non-conjugé

Application: Western Blotting (WB)

Specificité: C19 ORF15 antibody was raised against the C terminal Of C19 rf15

Purification: Affinity purified

Immunogène: C19 ORF15 antibody was raised using the C terminal Of C19 rf15 corresponding to a region with amino acids FFLIQDLVTGDSGSFQGSYVLLVVGGGPTLDSLKDYSEDEIYRFNSPLDK

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C19ORF15 Blocking Peptide, catalog no. 33R-2894, is also available for use as a blocking control in assays to test for specificity of this C19ORF15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CATSPERG

Antigène: CATSPERG (Cation Channel, Sperm-Associated, gamma (CATSPERG))

Autre désignation: C19ORF15 (CATSPERG Produits)

Synonymes: anticorps C19orf15, anticorps cation channel sperm associated auxiliary subunit gamma, anticorps CATSPERG

Sujet: C19orf15 is a single-pass type I membrane protein. The exact function of C19orf15 remains unknown.

Poids moléculaire: 92 kDa (MW of target protein)