TNMD anticorps (N-Term)

N° du produit ABIN635478

Cet anticorps anti-TNMD est un anticorps Lapin Polyclonal détectant TNMD dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour TNMD anticorps (N-Term) (ABIN635478)

Antigène: TNMD (Tenomodulin (TNMD))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TNMD est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TNMD anticorps

Épitope: N-Term

Specificité: Tenomodulin antibody was raised against the N terminal of TNMD

Purification: Affinity purified

Immunogène: Tenomodulin antibody was raised using the N terminal of TNMD corresponding to a region with amino acids KKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tenomodulin Blocking Peptide, (ABIN939863), is also available for use as a blocking control in assays to test for specificity of this Tenomodulin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNMD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TNMD

Antigène: TNMD (Tenomodulin (TNMD))

Autre désignation: Tenomodulin

Sujet: TNMD is a single-pass type II membrane proteinPotential. It belongs to the chondromodulin-1 family and contains 1 BRICHOS domain. TNMD may be an angiogenesis inhibitor.

Poids moléculaire: 37 kDa (MW of target protein)