FAM134A anticorps (N-Term)
-
- Antigène Tous les produits FAM134A
- FAM134A (Family with Sequence Similarity 134, Member A (FAM134A))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FAM134A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FAM134 A antibody was raised against the N terminal of FAM134
- Purification
- Affinity purified
- Immunogène
- FAM134 A antibody was raised using the N terminal of FAM134 corresponding to a region with amino acids AGSGARPHLLSVPELCRYLAESWLTFQIHLQELLQYKRQNPAQFCVRVCS
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FAM134A Blocking Peptide, catalog no. 33R-1221, is also available for use as a blocking control in assays to test for specificity of this FAM134A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM130 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FAM134A (Family with Sequence Similarity 134, Member A (FAM134A))
- Autre désignation
- FAM134A (FAM134A Produits)
- Sujet
- The function of FAM134 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 58 kDa (MW of target protein)
-