ESYT3 anticorps

N° du produit ABIN635488

Cet anticorps Lapin Polyclonal détecte spécifiquement ESYT3 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour ESYT3 anticorps (ABIN635488)

Antigène: ESYT3 (Extended Synaptotagmin-Like Protein 3 (ESYT3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ESYT3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ESYT3 anticorps

Purification: Affinity purified

Immunogène: FAM62 C antibody was raised using a synthetic peptide corresponding to a region with amino acids EVFEFMVYEVPGQDLEVDLYDEDTDRDDFLGSLQICLGDVMTNRVVDEWF

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM62C Blocking Peptide, (ABIN938169), is also available for use as a blocking control in assays to test for specificity of this FAM62C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM60 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ESYT3

Antigène: ESYT3 (Extended Synaptotagmin-Like Protein 3 (ESYT3))

Autre désignation: FAM62C

Sujet: FAM62C belongs to the extended synaptotagmin family. It is a single-pass membrane protein, and contains 3 C2 domains. FAM62C may play a role as calcium-regulated intrinsic membrane protein.

Poids moléculaire: 100 kDa (MW of target protein)