SPNS1/Spinster 1 anticorps

N° du produit ABIN635490

Détail du produit anti-SPNS1/Spinster 1 anticorps

Antigène: SPNS1/Spinster 1 (SPNS1) (Spinster Homolog 1 (SPNS1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SPNS1/Spinster 1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SPNS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPKSEEPEVPDQEGLQRIT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SPNS1 Blocking Peptide, catalog no. 33R-1219, is also available for use as a blocking control in assays to test for specificity of this SPNS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPNS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SPNS1/Spinster 1

Antigène: SPNS1/Spinster 1 (SPNS1) (Spinster Homolog 1 (SPNS1))

Autre désignation: SPNS1 (SPNS1 Produits)

Synonymes: anticorps etID64740.3, anticorps nrs, anticorps spinl, anticorps wu:fb95b12, anticorps wu:fi37e11, anticorps 2210013K02Rik, anticorps Spin1, anticorps Spinl, anticorps HSpin1, anticorps LAT, anticorps PP2030, anticorps SPIN1, anticorps SPINL, anticorps spinster, anticorps RGD1305613, anticorps sphingolipid transporter 1 (putative), anticorps spinster homolog 1 (Drosophila), anticorps spinster homolog 1, anticorps spinster homolog 1 L homeolog, anticorps sphingolipid transporter 1, anticorps SPNS1, anticorps spns1, anticorps Spns1, anticorps spns1.L

Sujet: SPNS1 is the Sphingolipid transporter. It may be involved in necrotic or autophagic cell death. It belongs to the major facilitator superfamily, spinster family.

Poids moléculaire: 56 kDa (MW of target protein)