LRRC37B anticorps (N-Term)

N° du produit ABIN635493

Cet anticorps anti-LRRC37B est un anticorps Lapin Polyclonal détectant LRRC37B dans WB. Adapté pour Humain.

Aperçu rapide pour LRRC37B anticorps (N-Term) (ABIN635493)

Antigène: LRRC37B (Leucine Rich Repeat Containing 37B (LRRC37B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRC37B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LRRC37B anticorps

Épitope: N-Term

Specificité: LRRC37 B antibody was raised against the N terminal of LRRC37

Purification: Affinity purified

Immunogène: LRRC37 B antibody was raised using the N terminal of LRRC37 corresponding to a region with amino acids VSRPTKFVVSPKNLKKDLAERWSLPEIVGIPHQLSKPQRQKQTLPDDYLS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC37B Blocking Peptide, (ABIN5614575), is also available for use as a blocking control in assays to test for specificity of this LRRC37B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRC37B

Antigène: LRRC37B (Leucine Rich Repeat Containing 37B (LRRC37B))

Autre désignation: LRRC37B

Sujet: The function of LRRC37B protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 105 kDa (MW of target protein)