LRRC37B anticorps (N-Term)

N° du produit ABIN635493

Détail du produit anti-LRRC37B anticorps

Antigène: LRRC37B (Leucine Rich Repeat Containing 37B (LRRC37B))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRC37B est non-conjugé

Application: Western Blotting (WB)

Specificité: LRRC37 B antibody was raised against the N terminal of LRRC37

Purification: Affinity purified

Immunogène: LRRC37 B antibody was raised using the N terminal of LRRC37 corresponding to a region with amino acids VSRPTKFVVSPKNLKKDLAERWSLPEIVGIPHQLSKPQRQKQTLPDDYLS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC37B Blocking Peptide, catalog no. 33R-9822, is also available for use as a blocking control in assays to test for specificity of this LRRC37B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRC37B

Antigène: LRRC37B (Leucine Rich Repeat Containing 37B (LRRC37B))

Autre désignation: LRRC37B (LRRC37B Produits)

Synonymes: anticorps DKFZp459F1551, anticorps leucine rich repeat containing 37B, anticorps leucine-rich repeat-containing protein 37B, anticorps LRRC37B, anticorps LOC749894

Sujet: The function of LRRC37B protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 105 kDa (MW of target protein)