TMEM132B anticorps (Middle Region)

N° du produit ABIN635495

Détail du produit anti-TMEM132B anticorps

Antigène: TMEM132B (Transmembrane Protein 132B (TMEM132B))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM132B est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM132 B antibody was raised against the middle region of TMEM132

Purification: Affinity purified

Immunogène: TMEM132 B antibody was raised using the middle region of TMEM132 corresponding to a region with amino acids VQEWFHRGTPVGQEESTNKSTTPQSPMEGKNKLLKSGGPDAFTSFPTQGK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM132B Blocking Peptide, catalog no. 33R-9746, is also available for use as a blocking control in assays to test for specificity of this TMEM132B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM130 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM132B

Antigène: TMEM132B (Transmembrane Protein 132B (TMEM132B))

Autre désignation: TMEM132B (TMEM132B Produits)

Synonymes: anticorps RGD1566191, anticorps AK220418, anticorps mKIAA1786, anticorps transmembrane protein 132B, anticorps Tmem132b, anticorps TMEM132B, anticorps tmem132b, anticorps LOC100556911, anticorps LOC100606383

Sujet: TMEM132B single-pass type I membrane protein. It belongs to the TMEM132 family. The exact function of TMEM132B is not known.

Poids moléculaire: 119 kDa (MW of target protein)