Sphingomyelin Synthase 2 anticorps (N-Term)

N° du produit ABIN635498

Détail du produit anti-Sphingomyelin Synthase 2 anticorps

Antigène: Sphingomyelin Synthase 2 (SGMS2)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Sphingomyelin Synthase 2 est non-conjugé

Application: Western Blotting (WB)

Specificité: SGMS2 antibody was raised against the N terminal of SGMS2

Purification: Affinity purified

Immunogène: SGMS2 antibody was raised using the N terminal of SGMS2 corresponding to a region with amino acids KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SGMS2 Blocking Peptide, catalog no. 33R-4377, is also available for use as a blocking control in assays to test for specificity of this SGMS2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGMS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Sphingomyelin Synthase 2

Antigène: Sphingomyelin Synthase 2 (SGMS2)

Autre désignation: SGMS2 (SGMS2 Produits)

Synonymes: anticorps SMS2, anticorps 4933405A16Rik, anticorps 5133401H06Rik, anticorps AI854299, anticorps RGD1305778, anticorps spermatin, anticorps sphingomyelin synthase 2, anticorps sgms2, anticorps SGMS2, anticorps Sgms2

Sujet: SGMS2 is a bidirectional lipid cholinephosphotransferase capable of converting phosphatidylcholine (PC) and ceramide to sphingomyelin (SM) and diacylglycerol (DAG) and vice versa. Direction is dependent on the relative concentrations of DAG and ceramide as phosphocholine acceptors. SGMS2 directly and specifically recognises the choline head group on the substrate. SGMS2 also requires two fatty chains on the choline-P donor molecule in order to be recognised efficiently as a substrate. SGMS2 does not function strictly as a SM synthase.

Poids moléculaire: 42 kDa (MW of target protein)