Claudin 18 anticorps (C-Term)

N° du produit ABIN635505

Cet anticorps anti-Claudin 18 est un anticorps Lapin Polyclonal détectant Claudin 18 dans WB. Adapté pour Humain.

Aperçu rapide pour Claudin 18 anticorps (C-Term) (ABIN635505)

Antigène: Claudin 18 (CLDN18)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Claudin 18 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Claudin 18 anticorps

Épitope: C-Term

Specificité: Claudin 18 antibody was raised against the C terminal of CLDN18

Purification: Affinity purified

Immunogène: Claudin 18 antibody was raised using the C terminal of CLDN18 corresponding to a region with amino acids PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE

Information d'application

Indications d'application: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Claudin 18 Blocking Peptide, (ABIN5612909), is also available for use as a blocking control in assays to test for specificity of this Claudin 18 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Claudin 18

Antigène: Claudin 18 (CLDN18)

Autre désignation: Claudin 18

Sujet: CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C