ACSL1 anticorps (C-Term)

N° du produit ABIN635510

L’anticorps Lapin Polyclonal anti-ACSL1 a été validé pour WB et IHC. Il convient pour détecter ACSL1 dans des échantillons de Humain.

Aperçu rapide pour ACSL1 anticorps (C-Term) (ABIN635510)

Antigène: ACSL1 (Acsl1) (Acyl-CoA Synthetase Long-Chain Family Member 1 (Acsl1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACSL1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-ACSL1 anticorps

Épitope: C-Term

Specificité: ACSL1 antibody was raised against the C terminal of ACSL1

Purification: Affinity purified

Immunogène: ACSL1 antibody was raised using the C terminal of ACSL1 corresponding to a region with amino acids GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACSL1 Blocking Peptide, (ABIN938946), is also available for use as a blocking control in assays to test for specificity of this ACSL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACSL1

Antigène: ACSL1 (Acsl1) (Acyl-CoA Synthetase Long-Chain Family Member 1 (Acsl1))

Autre désignation: ACSL1

Sujet: ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.

Poids moléculaire: 78 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha