ACSL1 anticorps (C-Term)
-
- Antigène Voir toutes ACSL1 (Acsl1) Anticorps
- ACSL1 (Acsl1) (Acyl-CoA Synthetase Long-Chain Family Member 1 (Acsl1))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACSL1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- ACSL1 antibody was raised against the C terminal of ACSL1
- Purification
- Affinity purified
- Immunogène
- ACSL1 antibody was raised using the C terminal of ACSL1 corresponding to a region with amino acids GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG
- Top Product
- Discover our top product Acsl1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACSL1 Blocking Peptide, catalog no. 33R-3560, is also available for use as a blocking control in assays to test for specificity of this ACSL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ACSL1 (Acsl1) (Acyl-CoA Synthetase Long-Chain Family Member 1 (Acsl1))
- Autre désignation
- ACSL1 (Acsl1 Produits)
- Synonymes
- anticorps ACS1, anticorps FACL1, anticorps FACL2, anticorps LACS, anticorps LACS1, anticorps LACS2, anticorps Acas, anticorps Acas1, anticorps Acs, anticorps FACS, anticorps Facl2, anticorps ACS, anticorps COAA, anticorps zgc:110081, anticorps CER8, anticorps ECERIFERUM 8, anticorps LONG-CHAIN ACYL-COA SYNTHASE 1, anticorps T8I13.8, anticorps F13F21.14, anticorps F13F21_14, anticorps LATERAL ROOT DEVELOPMENT 2, anticorps LRD2, anticorps long-chain acyl-CoA synthetase 2, anticorps acyl-CoA synthetase long chain family member 1, anticorps acyl-CoA synthetase long-chain family member 1, anticorps acyl-CoA synthetase long chain family member 1a, anticorps AMP-dependent synthetase and ligase family protein, anticorps long-chain acyl-CoA synthetase 2, anticorps ACSL1, anticorps Acsl1, anticorps acsl1a, anticorps LACS1, anticorps LACS2
- Sujet
- ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.
- Poids moléculaire
- 78 kDa (MW of target protein)
- Pathways
- Regulation of Lipid Metabolism by PPARalpha
-