ODF4 anticorps (N-Term)

N° du produit ABIN635514

Détail du produit anti-ODF4 anticorps

Antigène: ODF4 (Outer Dense Fiber of Sperm Tails 4 (ODF4))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ODF4 est non-conjugé

Application: Western Blotting (WB)

Specificité: ODF4 antibody was raised against the N terminal of ODF4

Purification: Affinity purified

Immunogène: ODF4 antibody was raised using the N terminal of ODF4 corresponding to a region with amino acids MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ODF4 Blocking Peptide, catalog no. 33R-5818, is also available for use as a blocking control in assays to test for specificity of this ODF4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ODF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ODF4

Antigène: ODF4 (Outer Dense Fiber of Sperm Tails 4 (ODF4))

Autre désignation: ODF4 (ODF4 Produits)

Synonymes: anticorps CT134, anticorps CT136, anticorps OPPO1, anticorps Oppo1, anticorps outer dense fiber of sperm tails 4, anticorps ODF4, anticorps Odf4

Sujet: ODF4 is the component of the outer dense fibers (ODF) of spermatozoa which could be involved in sperm tail structure, sperm movement and general organization of cellular cytoskeleton.

Poids moléculaire: 29 kDa (MW of target protein)