ERVW-1 anticorps (N-Term)

N° du produit ABIN635520

Détail du produit anti-ERVW-1 anticorps

Antigène: ERVW-1 (Endogenous Retrovirus Group W, Member 1 (ERVW-1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ERVW-1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ERVWE1 antibody was raised against the N terminal of ERVWE1

Purification: Affinity purified

Immunogène: ERVWE1 antibody was raised using the N terminal of ERVWE1 corresponding to a region with amino acids TQTGMSDGGGVQDQAREKHVKEVISQLTRVHGTSSPYKGLDLSKLHETLR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ERVWE1 Blocking Peptide, catalog no. 33R-9252, is also available for use as a blocking control in assays to test for specificity of this ERVWE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERVWE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ERVW-1

Antigène: ERVW-1 (Endogenous Retrovirus Group W, Member 1 (ERVW-1))

Autre désignation: ERVWE1 (ERVW-1 Produits)

Synonymes: anticorps ENV, anticorps ENVW, anticorps ERVWE1, anticorps HERV-7q, anticorps HERV-W-ENV, anticorps HERV7Q, anticorps HERVW, anticorps HERVWENV, anticorps endogenous retrovirus group W member 1, envelope, anticorps ERVW-1

Sujet: ERVWE1 or syncytin, is expressed in the placental syncytiotrophoblast and is involved in fusion of the cytotrophoblast cells to form the syncytial layer of the placenta. The protein has the characteristics of a typical retroviral envelope protein, including a furin cleavage site that separates the surface (SU) and transmembrane (TM) proteins which form a heterodimer. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

Poids moléculaire: 24 kDa (MW of target protein)