TPST2 anticorps (Middle Region)

N° du produit ABIN635521

Cet anticorps Lapin Polyclonal détecte spécifiquement TPST2 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour TPST2 anticorps (Middle Region) (ABIN635521)

Antigène: TPST2 (tyrosylprotein Sulfotransferase 2 (TPST2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TPST2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TPST2 anticorps

Épitope: Middle Region

Specificité: TPST2 antibody was raised against the middle region of TPST2

Purification: Affinity purified

Immunogène: TPST2 antibody was raised using the middle region of TPST2 corresponding to a region with amino acids KAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TPST2 Blocking Peptide, (ABIN939631), is also available for use as a blocking control in assays to test for specificity of this TPST2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPST2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TPST2

Antigène: TPST2 (tyrosylprotein Sulfotransferase 2 (TPST2))

Autre désignation: TPST2

Sujet: TPST2 catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. TPST2 is a type II integral membrane protein found in the Golgi body.

Poids moléculaire: 42 kDa (MW of target protein)