TPST2 anticorps (Middle Region)
-
- Antigène Voir toutes TPST2 Anticorps
- TPST2 (tyrosylprotein Sulfotransferase 2 (TPST2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TPST2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TPST2 antibody was raised against the middle region of TPST2
- Purification
- Affinity purified
- Immunogène
- TPST2 antibody was raised using the middle region of TPST2 corresponding to a region with amino acids KAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVL
- Top Product
- Discover our top product TPST2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TPST2 Blocking Peptide, catalog no. 33R-4245, is also available for use as a blocking control in assays to test for specificity of this TPST2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPST2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TPST2 (tyrosylprotein Sulfotransferase 2 (TPST2))
- Autre désignation
- TPST2 (TPST2 Produits)
- Synonymes
- anticorps zgc:64196, anticorps AI448750, anticorps D5Ucla3, anticorps Tango13b, anticorps grm, anticorps grt, anticorps TANGO13B, anticorps tyrosylprotein sulfotransferase 2, anticorps tyrosylprotein sulfotransferase 2 L homeolog, anticorps protein-tyrosine sulfotransferase 2, anticorps tpst2, anticorps TPST2, anticorps tpst2.L, anticorps Tpst2
- Sujet
- TPST2 catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. TPST2 is a type II integral membrane protein found in the Golgi body.
- Poids moléculaire
- 42 kDa (MW of target protein)
-