WDR33 anticorps (N-Term)

N° du produit ABIN635525

Détail du produit anti-WDR33 anticorps

Antigène: WDR33 (WD Repeat Domain 33 (WDR33))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WDR33 est non-conjugé

Application: Western Blotting (WB)

Specificité: WDR33 antibody was raised against the N terminal of WDR33

Purification: Affinity purified

Immunogène: WDR33 antibody was raised using the N terminal of WDR33 corresponding to a region with amino acids IWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDR33 Blocking Peptide, catalog no. 33R-4214, is also available for use as a blocking control in assays to test for specificity of this WDR33 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WDR33

Antigène: WDR33 (WD Repeat Domain 33 (WDR33))

Autre désignation: WDR33 (WDR33 Produits)

Synonymes: anticorps zgc:110570, anticorps WDR33, anticorps Wdr33, anticorps NET14, anticorps WDC146, anticorps 1110001N06Rik, anticorps 2310011G05Rik, anticorps 2810021O11Rik, anticorps 8430413N20Rik, anticorps WD repeat domain 33, anticorps pre-mRNA 3' end processing protein WDR33, anticorps wdr33, anticorps WDR33, anticorps Wdr33, anticorps LOC100548555

Sujet: WDR33 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.

Poids moléculaire: 38 kDa (MW of target protein)