UNC5A anticorps

N° du produit ABIN635530

Cet anticorps Lapin Polyclonal détecte spécifiquement UNC5A dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour UNC5A anticorps (ABIN635530)

Antigène: UNC5A (Unc-5 Homolog A (UNC5A))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UNC5A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UNC5A anticorps

Purification: Affinity purified

Immunogène: UNC5 A antibody was raised using a synthetic peptide corresponding to a region with amino acids VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UNC5A Blocking Peptide, (ABIN5616911), is also available for use as a blocking control in assays to test for specificity of this UNC5A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UNC5A

Antigène: UNC5A (Unc-5 Homolog A (UNC5A))

Autre désignation: UNC5A

Sujet: UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons.UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons.

Poids moléculaire: 93 kDa (MW of target protein)