SAYSD1 anticorps (C-Term)

N° du produit ABIN635537

L’anticorps Lapin Polyclonal anti-SAYSD1 a été validé pour WB. Il convient pour détecter SAYSD1 dans des échantillons de Humain et Rat.

Aperçu rapide pour SAYSD1 anticorps (C-Term) (ABIN635537)

Antigène: SAYSD1 (SAYSVFN Motif Domain Containing 1 (SAYSD1))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SAYSD1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SAYSD1 anticorps

Épitope: C-Term

Specificité: C6 ORF64 antibody was raised against the C terminal Of C6 rf64

Purification: Affinity purified

Immunogène: C6 ORF64 antibody was raised using the C terminal Of C6 rf64 corresponding to a region with amino acids MYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPLAGR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C6ORF64 Blocking Peptide, (ABIN5612538), is also available for use as a blocking control in assays to test for specificity of this C6ORF64 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF64 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SAYSD1

Antigène: SAYSD1 (SAYSVFN Motif Domain Containing 1 (SAYSD1))

Autre désignation: C6ORF64

Sujet: The function of C6orf64 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 20 kDa (MW of target protein)