PRSS16 anticorps

N° du produit ABIN635540

Détail du produit anti-PRSS16 anticorps

Antigène: PRSS16 (Protease, serine, 16 (Thymus) (PRSS16))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRSS16 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PRSS16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRSS16 Blocking Peptide, catalog no. 33R-8518, is also available for use as a blocking control in assays to test for specificity of this PRSS16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRSS16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRSS16

Antigène: PRSS16 (Protease, serine, 16 (Thymus) (PRSS16))

Autre désignation: PRSS16 (PRSS16 Produits)

Synonymes: anticorps TSSP, anticorps AI448615, anticorps protease, serine 16, anticorps protease, serine 16 S homeolog, anticorps protease, serine 16 (thymus), anticorps PRSS16, anticorps prss16.S, anticorps prss16, anticorps Prss16

Sujet: This gene encodes a serine protease expressed exclusively in the thymus. It is thought to play a role in the alternative antigen presenting pathway used by cortical thymic epithelial cells during the positive selection of T cells.

Poids moléculaire: 55 kDa (MW of target protein)