GOLGA5 anticorps (N-Term)

N° du produit ABIN635542

Détail du produit anti-GOLGA5 anticorps

Antigène: GOLGA5 (Golgin A5 (GOLGA5))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GOLGA5 est non-conjugé

Application: Western Blotting (WB)

Specificité: GOLGA5 antibody was raised against the N terminal of GOLGA5

Purification: Affinity purified

Immunogène: GOLGA5 antibody was raised using the N terminal of GOLGA5 corresponding to a region with amino acids FVRRKKSEPDDELLFDFLNSSQKEPTGRVEIRKEKGKTPVFQSSQTSSVS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GOLGA5 Blocking Peptide, catalog no. 33R-3120, is also available for use as a blocking control in assays to test for specificity of this GOLGA5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOLGA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GOLGA5

Antigène: GOLGA5 (Golgin A5 (GOLGA5))

Autre désignation: GOLGA5 (GOLGA5 Produits)

Synonymes: anticorps GOLIM5, anticorps RFG5, anticorps ret-II, anticorps golim5, anticorps ret-ii, anticorps rfg5, anticorps Ret-II, anticorps im:7153094, anticorps sb:cb898, anticorps wu:fd50h11, anticorps zgc:66400, anticorps golgin A5, anticorps golgin A5 L homeolog, anticorps golgi autoantigen, golgin subfamily a, 5, anticorps GOLGA5, anticorps golga5.L, anticorps golga5, anticorps Golga5

Sujet: GOLGA5 is a member of the golgin family of proteins, whose members localize to the Golgi. This protein is a coiled-coil membrane protein that has been postulated to play a role in vesicle tethering and docking. Translocations involving this gene and the ret proto-oncogene have been found in tumor tissues.

Poids moléculaire: 83 kDa (MW of target protein)