AWAT2 anticorps (C-Term)

N° du produit ABIN635543

Détail du produit anti-AWAT2 anticorps

Antigène: AWAT2 (Acyl-CoA Wax Alcohol Acyltransferase 2 (AWAT2))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AWAT2 est non-conjugé

Application: Western Blotting (WB)

Specificité: DGAT2 L4 antibody was raised against the C terminal of DGAT2 4

Purification: Affinity purified

Immunogène: DGAT2 L4 antibody was raised using the C terminal of DGAT2 4 corresponding to a region with amino acids GEPLPMPKIENPSQEIVAKYHTLYIDALRKLFDQHKTKFGISETQELEII

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DGAT2L4 Blocking Peptide, catalog no. 33R-3242, is also available for use as a blocking control in assays to test for specificity of this DGAT2L4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGAT0 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AWAT2

Antigène: AWAT2 (Acyl-CoA Wax Alcohol Acyltransferase 2 (AWAT2))

Autre désignation: DGAT2L4 (AWAT2 Produits)

Synonymes: anticorps DGAT2L4, anticorps ARAT, anticorps DC4, anticorps MFAT, anticorps WS, anticorps 9430062J17Rik, anticorps Dgat2l4, anticorps RGD1565111, anticorps acyl-CoA wax alcohol acyltransferase 2, anticorps AWAT2, anticorps Awat2

Sujet: DGAT2L4 is acyltransferase that predominantly esterify long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that it plays a central role in lipid metabolism in skin. It has no activity using decyl alcohol and significantly prefers the C16 and C18 alcohols.

Poids moléculaire: 38 kDa (MW of target protein)