OCA2 anticorps (Middle Region)

N° du produit ABIN635550

Cet anticorps anti-OCA2 est un anticorps Lapin Polyclonal détectant OCA2 dans WB. Adapté pour Humain et Souris. Ce Primary Antibody a été cité dans 1 publication.

Aperçu rapide pour OCA2 anticorps (Middle Region) (ABIN635550)

Antigène: OCA2 (P Protein (OCA2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OCA2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-OCA2 anticorps

Épitope: Middle Region

Specificité: OCA2 antibody was raised against the middle region of OCA2

Purification: Affinity purified

Immunogène: OCA2 antibody was raised using the middle region of OCA2 corresponding to a region with amino acids LIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIGIC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OCA2 Blocking Peptide, (ABIN940422), is also available for use as a blocking control in assays to test for specificity of this OCA2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OCA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Références pour anticorps anti-OCA2 (ABIN635550)

Jeffery: "Distal Regeneration Involves the Age Dependent Activity of Branchial Sac Stem Cells in the Ascidian Ciona intestinalis." dans: Regeneration (Oxford, England), Vol. 2, Issue 1, pp. 1-18, (2015) (PubMed).

Détails sur OCA2

Antigène: OCA2 (P Protein (OCA2))

Autre désignation: OCA2

Classe de substances: Viral Protein

Sujet: This gene encodes the human homologue of the mouse p (pink-eyed dilution) gene. The encoded protein is believed to be an integral membrane protein involved in small molecule transport, specifically tyrosine - a precursor of melanin. Mutations in this gene result in type 2 oculocutaneous albinism.

Poids moléculaire: 93 kDa (MW of target protein)