PIPOX anticorps (C-Term)

N° du produit ABIN635559

Cet anticorps anti-PIPOX est un anticorps Lapin Polyclonal détectant PIPOX dans WB. Adapté pour Humain, Souris, Rat et Chien.

Aperçu rapide pour PIPOX anticorps (C-Term) (ABIN635559)

Antigène: PIPOX (Pipecolic Acid Oxidase (PIPOX))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIPOX est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PIPOX anticorps

Épitope: C-Term

Specificité: PIPOX antibody was raised against the C terminal of PIPOX

Purification: Affinity purified

Immunogène: PIPOX antibody was raised using the C terminal of PIPOX corresponding to a region with amino acids FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PIPOX Blocking Peptide, (ABIN938505), is also available for use as a blocking control in assays to test for specificity of this PIPOX antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIPOX antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PIPOX

Antigène: PIPOX (Pipecolic Acid Oxidase (PIPOX))

Autre désignation: PIPOX

Sujet: PIPOX metabolizes sarcosine, L-pipecolic acid and L-proline.

Poids moléculaire: 43 kDa (MW of target protein)