UBAC2 anticorps (Middle Region)

N° du produit ABIN635562

Cet anticorps anti-UBAC2 Polyclonal Lapin (ABIN635562) détecte spécifiquement UBAC2 dans WB. L’anticorps est réactif avec des échantillons de Humain et Souris.

Aperçu rapide pour UBAC2 anticorps (Middle Region) (ABIN635562)

Antigène: UBAC2 (UBA Domain Containing 2 (UBAC2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBAC2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UBAC2 anticorps

Épitope: Middle Region

Specificité: UBAC2 antibody was raised against the middle region of UBAC2

Purification: Affinity purified

Immunogène: UBAC2 antibody was raised using the middle region of UBAC2 corresponding to a region with amino acids YCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBAC2 Blocking Peptide, (ABIN936019), is also available for use as a blocking control in assays to test for specificity of this UBAC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBAC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBAC2

Antigène: UBAC2 (UBA Domain Containing 2 (UBAC2))

Autre désignation: UBAC2

Sujet: The function of UBAC2 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 35 kDa (MW of target protein)