MGC4172 (C-Term) anticorps

N° du produit ABIN635565

Détail du produit

Antigène: MGC4172

Épitope: C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: MGC4172 antibody was raised against the C terminal of MGC4172

Purification: Affinity purified

Immunogène: MGC4172 antibody was raised using the C terminal of MGC4172 corresponding to a region with amino acids VETQFAFKLHDKDPEKAAATYEQMKCLKPEDVAEAVIYVLSTPAHIQIGD

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MGC4172 Blocking Peptide, catalog no. 33R-9515, is also available for use as a blocking control in assays to test for specificity of this MGC4172 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC4172 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: MGC4172

Sujet: MGC4172 possesses oxidoreductase activity.

Poids moléculaire: 19 kDa (MW of target protein)