PCDH15 anticorps (N-Term)

N° du produit ABIN635568

Détail du produit anti-PCDH15 anticorps

Antigène: PCDH15 (Protocadherin-15 (PCDH15))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCDH15 est non-conjugé

Application: Western Blotting (WB)

Specificité: PCDH15 antibody was raised against the N terminal of PCDH15

Purification: Affinity purified

Immunogène: PCDH15 antibody was raised using the N terminal of PCDH15 corresponding to a region with amino acids HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCDH15 Blocking Peptide, catalog no. 33R-3853, is also available for use as a blocking control in assays to test for specificity of this PCDH15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDH15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCDH15

Antigène: PCDH15 (Protocadherin-15 (PCDH15))

Autre désignation: PCDH15 (PCDH15 Produits)

Synonymes: anticorps CDHR15, anticorps DFNB23, anticorps USH1F, anticorps BB078305, anticorps ENSMUSG00000046980, anticorps Gm9815, anticorps Ush1f, anticorps av, anticorps nmf19, anticorps protocadherin-15, anticorps protocadherin related 15, anticorps protocadherin-15, anticorps protocadherin 15, anticorps PCDH15, anticorps CpipJ_CPIJ005081, anticorps Pcdh15

Sujet: PCDH15 is a member of the cadherin superfamily. Family members encode integral membrane proteins that mediate calcium-dependent cell-cell adhesion. PCDH15 consists of a signal peptide, 11 extracellular calcium-binding domains, a transmembrane domain and a unique cytoplasmic domain. It plays an essential role in maintenance of normal retinal and cochlear function. Mutations in this gene have been associated with hearing loss, which is consistent with its location at the Usher syndrome type 1F (USH1F) critical region on chromosome 10.

Poids moléculaire: 80 kDa (MW of target protein)

Pathways: Sensory Perception of Sound