TMPRSS5 anticorps
-
- Antigène Voir toutes TMPRSS5 Anticorps
- TMPRSS5 (Transmembrane Protease, serine 5 (TMPRSS5))
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TMPRSS5 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- TMPRSS5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SWRVHAGLVSHSAVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQTALN
- Top Product
- Discover our top product TMPRSS5 Anticorps primaire
-
-
- Indications d'application
-
WB: 2 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TMPRSS5 Blocking Peptide, catalog no. 33R-8944, is also available for use as a blocking control in assays to test for specificity of this TMPRSS5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TMPRSS5 (Transmembrane Protease, serine 5 (TMPRSS5))
- Autre désignation
- TMPRSS5 (TMPRSS5 Produits)
- Synonymes
- anticorps TMPRSS5, anticorps SPINESIN, anticorps Amp, anticorps spinesin, anticorps transmembrane protease, serine 5, anticorps transmembrane protease, serine 5 (spinesin), anticorps TMPRSS5, anticorps Tmprss5
- Sujet
- TMPRSS5 belongs to the serine protease family. Serine proteases are known to be involved in many physiological and pathological processes. TMPRSS5 may play a role in hearing.
- Poids moléculaire
- 22 kDa (MW of target protein)
-