TMPRSS5 anticorps

N° du produit ABIN635571

Détail du produit anti-TMPRSS5 anticorps

Antigène: TMPRSS5 (Transmembrane Protease, serine 5 (TMPRSS5))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMPRSS5 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TMPRSS5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SWRVHAGLVSHSAVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQTALN

Information d'application

Indications d'application: WB: 2 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMPRSS5 Blocking Peptide, catalog no. 33R-8944, is also available for use as a blocking control in assays to test for specificity of this TMPRSS5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMPRSS5

Antigène: TMPRSS5 (Transmembrane Protease, serine 5 (TMPRSS5))

Autre désignation: TMPRSS5 (TMPRSS5 Produits)

Synonymes: anticorps TMPRSS5, anticorps SPINESIN, anticorps Amp, anticorps spinesin, anticorps transmembrane protease, serine 5, anticorps transmembrane protease, serine 5 (spinesin), anticorps TMPRSS5, anticorps Tmprss5

Sujet: TMPRSS5 belongs to the serine protease family. Serine proteases are known to be involved in many physiological and pathological processes. TMPRSS5 may play a role in hearing.

Poids moléculaire: 22 kDa (MW of target protein)