PLP1 anticorps

N° du produit ABIN635572

Cet anticorps Lapin Polyclonal détecte spécifiquement PLP1 dans WB. Il présente une réactivité avec des échantillons de Humain, Rat, Souris et Chien.

Aperçu rapide pour PLP1 anticorps (ABIN635572)

Antigène: PLP1 (Proteolipid Protein 1 (PLP1))

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PLP1 anticorps

Purification: Affinity purified

Immunogène: PLP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGAL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLP1 Blocking Peptide, (ABIN938693), is also available for use as a blocking control in assays to test for specificity of this PLP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PLP1

Antigène: PLP1 (Proteolipid Protein 1 (PLP1))

Autre désignation: PLP1

Sujet: PLP1 is a transmembrane proteolipid protein that is the predominant myelin protein present in the central nervous system. It may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause X-linked Pelizaeus-Merzbacher disease and spastic paraplegia type 2. Alternatively spliced transcript variants encoding distinct isoforms or having different 5' UTRs, have been identified for this gene.

Poids moléculaire: 30 kDa (MW of target protein)