Sideroflexin 4 anticorps (C-Term)

N° du produit ABIN635574

Cet anticorps anti-Sideroflexin 4 est un anticorps Lapin Polyclonal détectant Sideroflexin 4 dans WB. Adapté pour Humain.

Aperçu rapide pour Sideroflexin 4 anticorps (C-Term) (ABIN635574)

Antigène: Sideroflexin 4 (SFXN4)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Sideroflexin 4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Sideroflexin 4 anticorps

Épitope: C-Term

Specificité: Sideroflexin 4 antibody was raised against the C terminal of SFXN4

Purification: Affinity purified

Immunogène: Sideroflexin 4 antibody was raised using the C terminal of SFXN4 corresponding to a region with amino acids SCTVLAMGLMVPFSFSIFPQIGQIQYCSLEEKIQSPTEETEIFYHRGV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Sideroflexin 4 Blocking Peptide, (ABIN5616141), is also available for use as a blocking control in assays to test for specificity of this Sideroflexin 4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFXN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Sideroflexin 4

Antigène: Sideroflexin 4 (SFXN4)

Autre désignation: Sideroflexin 4

Sujet: SFXN4 is a multi-pass membrane protein. It belongs to the sideroflexin family. SFXN4 is a potential iron transporter.

Poids moléculaire: 38 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis