PLP1 anticorps (Middle Region)

N° du produit ABIN635575

Détail du produit anti-PLP1 anticorps

Antigène: PLP1 (Proteolipid Protein 1 (PLP1))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PLP1 antibody was raised against the middle region of PLP1

Purification: Affinity purified

Immunogène: PLP1 antibody was raised using the middle region of PLP1 corresponding to a region with amino acids IYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLP1 Blocking Peptide, catalog no. 33R-4219, is also available for use as a blocking control in assays to test for specificity of this PLP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PLP1

Antigène: PLP1 (Proteolipid Protein 1 (PLP1))

Autre désignation: PLP1 (PLP1 Produits)

Sujet: PLP1 is a transmembrane proteolipid protein that is the predominant myelin protein present in the central nervous system. It may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause X-linked Pelizaeus-Merzbacher disease and spastic paraplegia type 2.

Poids moléculaire: 30 kDa (MW of target protein)