TMEM8B anticorps (N-Term)

N° du produit ABIN635576

Détail du produit anti-TMEM8B anticorps

Antigène: TMEM8B (Transmembrane Protein 8B (TMEM8B))

Épitope: N-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM8B est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: C9 ORF127 antibody was raised against the N terminal Of C9 rf127

Purification: Affinity purified

Immunogène: C9 ORF127 antibody was raised using the N terminal Of C9 rf127 corresponding to a region with amino acids MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFS

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C9ORF127 Blocking Peptide, catalog no. 33R-6253, is also available for use as a blocking control in assays to test for specificity of this C9ORF127 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF127 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM8B

Antigène: TMEM8B (Transmembrane Protein 8B (TMEM8B))

Autre désignation: C9ORF127 (TMEM8B Produits)

Synonymes: anticorps TMEM8B, anticorps C9orf127, anticorps NAG-5, anticorps NGX6, anticorps RP11-112J3.10, anticorps RGD1310012, anticorps 4930500O05Rik, anticorps transmembrane protein 8B, anticorps TMEM8B, anticorps tmem8b, anticorps Tmem8b

Sujet: The down-regulation of C9orf127 may be closely associated with tumorigenesis and metastasis of colorectal carcinoma. However, it may not contribute to the development and progression of gastric carcinoma.

Poids moléculaire: 37 kDa (MW of target protein)