FAM200A anticorps (Middle Region)

N° du produit ABIN635578

Détail du produit anti-FAM200A anticorps

Antigène: FAM200A (C7orf38) (Chromosome 7 Open Reading Frame 38 (C7orf38))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM200A est non-conjugé

Application: Western Blotting (WB)

Specificité: C7 ORF38 antibody was raised against the middle region of C7 rf38

Purification: Affinity purified

Immunogène: C7 ORF38 antibody was raised using the middle region of C7 rf38 corresponding to a region with amino acids QTFNYYFPEEKFESLKENIWMKDPFAFQNPESIIELNLEPEEENELLQLS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C7ORF38 Blocking Peptide, catalog no. 33R-7749, is also available for use as a blocking control in assays to test for specificity of this C7ORF38 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF38 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM200A

Antigène: FAM200A (C7orf38) (Chromosome 7 Open Reading Frame 38 (C7orf38))

Autre désignation: C7ORF38 (C7orf38 Produits)

Synonymes: anticorps C7orf38, anticorps family with sequence similarity 200 member A, anticorps FAM200A

Sujet: The function of C7ORF38 protein has not been widely studied, and is yet to be fully elucidated. The protein is weakly similar to transposase-like proteins in human and mouse.

Poids moléculaire: 66 kDa (MW of target protein)