LRRC37A3 anticorps (Middle Region)

N° du produit ABIN635583

Cet anticorps anti-LRRC37A3 est un anticorps Lapin Polyclonal détectant LRRC37A3 dans WB. Adapté pour Humain.

Aperçu rapide pour LRRC37A3 anticorps (Middle Region) (ABIN635583)

Antigène: LRRC37A3 (Leucine Rich Repeat Containing 37, Member A3 (LRRC37A3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRC37A3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LRRC37A3 anticorps

Épitope: Middle Region

Specificité: LRRC37 A3 antibody was raised against the middle region of LRRC37 3

Purification: Affinity purified

Immunogène: LRRC37 A3 antibody was raised using the middle region of LRRC37 3 corresponding to a region with amino acids NYTSTELIIEPEEPSDSSGINLSGFGSEQLDTNDESDVTSTLSYILPYFS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC37A3 Blocking Peptide, (ABIN5614574), is also available for use as a blocking control in assays to test for specificity of this LRRC37A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC30 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRC37A3

Antigène: LRRC37A3 (Leucine Rich Repeat Containing 37, Member A3 (LRRC37A3))

Autre désignation: LRRC37A3

Sujet: The function of LRRC37A3 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 180 kDa (MW of target protein)