JAM3 anticorps (N-Term)

N° du produit ABIN635598

Cet anticorps anti-JAM3 est un anticorps Lapin Polyclonal détectant JAM3 dans WB. Adapté pour Humain et Souris.

Aperçu rapide pour JAM3 anticorps (N-Term) (ABIN635598)

Antigène: JAM3 (Junctional Adhesion Molecule 3 (JAM3))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp JAM3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-JAM3 anticorps

Épitope: N-Term

Specificité: JAM3 antibody was raised against the N terminal of JAM3

Purification: Affinity purified

Immunogène: JAM3 antibody was raised using the N terminal of JAM3 corresponding to a region with amino acids SSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

JAM3 Blocking Peptide, (ABIN5614235), is also available for use as a blocking control in assays to test for specificity of this JAM3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JAM3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur JAM3

Antigène: JAM3 (Junctional Adhesion Molecule 3 (JAM3))

Autre désignation: JAM3

Sujet: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. JAM3, one member of the immunoglobulin superfamily, is localized in the tight junctions between high endothelial cells. Unlike other proteins in this family, this protein is unable to adhere to leukocyte cell lines and only forms weak homotypic interactions. JAM3 is a member of the junctional adhesion molecule protein family and acts as a receptor for another member of this family.

Poids moléculaire: 28 kDa (MW of target protein)