C1orf159 anticorps (C-Term)

N° du produit ABIN635604

Détail du produit anti-C1orf159 anticorps

Antigène: C1orf159 (Chromosome 1 Open Reading Frame 159 (C1orf159))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C1orf159 est non-conjugé

Application: Western Blotting (WB)

Specificité: C1 ORF159 antibody was raised against the C terminal Of C1 rf159

Purification: Affinity purified

Immunogène: C1 ORF159 antibody was raised using the C terminal Of C1 rf159 corresponding to a region with amino acids PLPGSPGDPPTRQGQGRIWLVPPALDLSWIWPAPPARPPLIPVTSMLFPV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C1ORF159 Blocking Peptide, catalog no. 33R-7201, is also available for use as a blocking control in assays to test for specificity of this C1ORF159 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF159 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C1orf159

Antigène: C1orf159 (Chromosome 1 Open Reading Frame 159 (C1orf159))

Autre désignation: C1ORF159 (C1orf159 Produits)

Synonymes: anticorps DKFZp459M0116, anticorps chromosome 21 C1orf159 homolog, anticorps chromosome 1 open reading frame 159, anticorps chromosome 1 open reading frame, human C1orf159, anticorps C21H1orf159, anticorps c1orf159, anticorps C1H1orf159, anticorps C1orf159

Sujet: The function of C1orf159 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 42 kDa (MW of target protein)