TMEM117 anticorps (Middle Region)

N° du produit ABIN635605

Cet anticorps Lapin Polyclonal détecte spécifiquement TMEM117 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour TMEM117 anticorps (Middle Region) (ABIN635605)

Antigène: TMEM117 (Transmembrane Protein 117 (TMEM117))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM117 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMEM117 anticorps

Épitope: Middle Region

Specificité: TMEM117 antibody was raised against the middle region of TMEM117

Purification: Affinity purified

Immunogène: TMEM117 antibody was raised using the middle region of TMEM117 corresponding to a region with amino acids GQYIGPGQKIYTVKDSESLKDLNRTKLSWEWRSNHTNPRTNKTYVEGDMF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM117 Blocking Peptide, (ABIN938906), is also available for use as a blocking control in assays to test for specificity of this TMEM117 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM117 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM117

Antigène: TMEM117 (Transmembrane Protein 117 (TMEM117))

Autre désignation: TMEM117

Sujet: TMEM117 is a multi-pass membrane protein. It belongs to the TMEM117 family. The exact function of TMEM117 remains unknown.

Poids moléculaire: 45 kDa (MW of target protein)