TMEM117 anticorps (Middle Region)

N° du produit ABIN635605

Détail du produit anti-TMEM117 anticorps

Antigène: TMEM117 (Transmembrane Protein 117 (TMEM117))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM117 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM117 antibody was raised against the middle region of TMEM117

Purification: Affinity purified

Immunogène: TMEM117 antibody was raised using the middle region of TMEM117 corresponding to a region with amino acids GQYIGPGQKIYTVKDSESLKDLNRTKLSWEWRSNHTNPRTNKTYVEGDMF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM117 Blocking Peptide, catalog no. 33R-3520, is also available for use as a blocking control in assays to test for specificity of this TMEM117 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM117 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM117

Antigène: TMEM117 (Transmembrane Protein 117 (TMEM117))

Autre désignation: TMEM117 (TMEM117 Produits)

Synonymes: anticorps wu:fi32b02, anticorps zgc:55574, anticorps MGC154839, anticorps B930062P21Rik, anticorps RGD1562562, anticorps transmembrane protein 117, anticorps transmembrane protein 117 S homeolog, anticorps tmem117, anticorps TMEM117, anticorps tmem117.S, anticorps LOC100472537, anticorps Tmem117

Sujet: TMEM117 is a multi-pass membrane protein. It belongs to the TMEM117 family. The exact function of TMEM117 remains unknown.

Poids moléculaire: 45 kDa (MW of target protein)