SERINC2 anticorps (N-Term)

N° du produit ABIN635607

Détail du produit anti-SERINC2 anticorps

Antigène: SERINC2 (serine Incorporator 2 (SERINC2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SERINC2 est non-conjugé

Application: Western Blotting (WB)

Specificité: SERINC2 antibody was raised against the N terminal of SERINC2

Purification: Affinity purified

Immunogène: SERINC2 antibody was raised using the N terminal of SERINC2 corresponding to a region with amino acids VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SERINC2 Blocking Peptide, catalog no. 33R-9449, is also available for use as a blocking control in assays to test for specificity of this SERINC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERINC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SERINC2

Antigène: SERINC2 (serine Incorporator 2 (SERINC2))

Autre désignation: SERINC2 (SERINC2 Produits)

Synonymes: anticorps 2310004K20Rik, anticorps AW121759, anticorps FKSG84, anticorps TDE2, anticorps Tde2l, anticorps PRO0899, anticorps TDE2L, anticorps serine incorporator 2, anticorps Serinc2, anticorps SERINC2

Sujet: The function of SERINC2 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 51 kDa (MW of target protein)