TMCC2 anticorps (N-Term)

N° du produit ABIN635608

Détail du produit anti-TMCC2 anticorps

Antigène: TMCC2 (Transmembrane and Coiled-Coil Domain Family 2 (TMCC2))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMCC2 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMCC2 antibody was raised against the N terminal of TMCC2

Purification: Affinity purified

Immunogène: TMCC2 antibody was raised using the N terminal of TMCC2 corresponding to a region with amino acids GETTGANSAGGPTSDAGAAAAPNPGPRSKPPDLKKIQQLSEGSMFGHGLK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMCC2 Blocking Peptide, catalog no. 33R-3253, is also available for use as a blocking control in assays to test for specificity of this TMCC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMCC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMCC2

Antigène: TMCC2 (Transmembrane and Coiled-Coil Domain Family 2 (TMCC2))

Autre désignation: TMCC2 (TMCC2 Produits)

Synonymes: anticorps 1110063G11Rik, anticorps RGD1311960, anticorps HUCEP11, anticorps zgc:198155, anticorps zgc:198157, anticorps transmembrane and coiled-coil domains 2, anticorps transmembrane and coiled-coil domain family 2, anticorps Tmcc2, anticorps TMCC2, anticorps TMCO2, anticorps tmcc2

Sujet: TMCC2 is a multi-pass membrane protein. It belongs to the TEX28 family. The function of TMCC2 remains unknown.

Poids moléculaire: 77 kDa (MW of target protein)