SLC38A3 anticorps (N-Term)

N° du produit ABIN635610

Cet anticorps anti-SLC38A3 est un anticorps Lapin Polyclonal détectant SLC38A3 dans WB. Adapté pour Humain et Souris.

Aperçu rapide pour SLC38A3 anticorps (N-Term) (ABIN635610)

Antigène: SLC38A3 (Solute Carrier Family 38 Member 3 (SLC38A3))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC38A3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC38A3 anticorps

Épitope: N-Term

Specificité: SLC38 A3 antibody was raised against the N terminal of SLC38 3

Purification: Affinity purified

Immunogène: SLC38 A3 antibody was raised using the N terminal of SLC38 3 corresponding to a region with amino acids GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC38A3 Blocking Peptide, (ABIN938842), is also available for use as a blocking control in assays to test for specificity of this SLC38A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC38A3

Antigène: SLC38A3 (Solute Carrier Family 38 Member 3 (SLC38A3))

Autre désignation: SLC38A3

Sujet: As a sodium-dependent amino acid/proton antiporter, SLC38A3 mediates electrogenic cotransport of glutamine and sodium ions in exchange for protons. It also recognises histidine, asparagine and alanine. It may mediate amino acid transport in either direction under physiological conditions and play a role in nitrogen metabolism and synaptic transmission.

Poids moléculaire: 56 kDa (MW of target protein)