SLC38A3 anticorps (N-Term)

N° du produit ABIN635610

Détail du produit anti-SLC38A3 anticorps

Antigène: SLC38A3 (Solute Carrier Family 38 Member 3 (SLC38A3))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC38A3 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC38 A3 antibody was raised against the N terminal of SLC38 3

Purification: Affinity purified

Immunogène: SLC38 A3 antibody was raised using the N terminal of SLC38 3 corresponding to a region with amino acids GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC38A3 Blocking Peptide, catalog no. 33R-3456, is also available for use as a blocking control in assays to test for specificity of this SLC38A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC38A3

Antigène: SLC38A3 (Solute Carrier Family 38 Member 3 (SLC38A3))

Autre désignation: SLC38A3 (SLC38A3 Produits)

Synonymes: anticorps slc38a3, anticorps wu:fc31c02, anticorps wu:fc48a10, anticorps zgc:92015, anticorps MGC69392, anticorps G17, anticorps NAT1, anticorps SN1, anticorps 0610012J02Rik, anticorps D9Ucla2, anticorps Nat1, anticorps Slc38-3, anticorps Sn1, anticorps Snat3, anticorps mNAT, anticorps solute carrier family 38, member 5b, anticorps solute carrier family 38 member 3, anticorps solute carrier family 38, member 3, anticorps slc38a5b, anticorps slc38a3, anticorps SLC38A3, anticorps Slc38a3

Sujet: As a sodium-dependent amino acid/proton antiporter, SLC38A3 mediates electrogenic cotransport of glutamine and sodium ions in exchange for protons. It also recognises histidine, asparagine and alanine. It may mediate amino acid transport in either direction under physiological conditions and play a role in nitrogen metabolism and synaptic transmission.

Poids moléculaire: 56 kDa (MW of target protein)