YIPF6 anticorps (C-Term)
-
- Antigène Tous les produits YIPF6
- YIPF6 (Yip1 Domain Family, Member 6 (YIPF6))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp YIPF6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- YIPF6 antibody was raised against the C terminal of YIPF6
- Purification
- Affinity purified
- Immunogène
- YIPF6 antibody was raised using the C terminal of YIPF6 corresponding to a region with amino acids MVRLFVVIVMFAWSIVASTALLADSQPPNRRALAVYPVFLFYFVISWMIL
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
YIPF6 Blocking Peptide, catalog no. 33R-6602, is also available for use as a blocking control in assays to test for specificity of this YIPF6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YIPF6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- YIPF6 (Yip1 Domain Family, Member 6 (YIPF6))
- Autre désignation
- YIPF6 (YIPF6 Produits)
- Synonymes
- anticorps DDBDRAFT_0204973, anticorps DDBDRAFT_0233687, anticorps DDB_0204973, anticorps DDB_0233687, anticorps zgc:86904, anticorps FinGER6, anticorps A430107J06Rik, anticorps Yip1 domain family member 6, anticorps Yipf6 protein, anticorps protein YIPF6, anticorps Yip1 domain-containing protein, anticorps YIPF6-like protein, anticorps YIPF6, anticorps protein YIPF6-like, anticorps Yip1 domain family, member 6, anticorps Yip1 domain family member 6 L homeolog, anticorps YIPF6, anticorps yipf6, anticorps Yipf6, anticorps EDI_154100, anticorps PITG_00974, anticorps VDBG_00769, anticorps LOC100366793, anticorps yipf6.L
- Sujet
- YIPF6 is a multi-pass membrane proteinPotential. It belongs to the YIP1 family. The exact function of YIPF6 remains unknown.
- Poids moléculaire
- 26 kDa (MW of target protein)
-