SIDT2 anticorps (N-Term)

N° du produit ABIN635622

Cet anticorps anti-SIDT2 Polyclonal Lapin (ABIN635622) détecte spécifiquement SIDT2 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour SIDT2 anticorps (N-Term) (ABIN635622)

Antigène: SIDT2 (SID1 Transmembrane Family, Member 2 (SIDT2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SIDT2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SIDT2 anticorps

Épitope: N-Term

Specificité: SIDT2 antibody was raised against the N terminal of SIDT2

Purification: Affinity purified

Immunogène: SIDT2 antibody was raised using the N terminal of SIDT2 corresponding to a region with amino acids LNKQKGAPLLFVVRQKEAVVSFQVPLILRGMFQRKYLYQKVERTLCQPPT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SIDT2 Blocking Peptide, (ABIN5616142), is also available for use as a blocking control in assays to test for specificity of this SIDT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIDT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SIDT2

Antigène: SIDT2 (SID1 Transmembrane Family, Member 2 (SIDT2))

Autre désignation: SIDT2

Sujet: SIDT2 belongs to the SID1 family. It is a multi-pass membrane protein. The exact function of SIDT2 remains unknown.

Poids moléculaire: 94 kDa (MW of target protein)