TRAM1L1 anticorps (Middle Region)

N° du produit ABIN635623

Cet anticorps Lapin Polyclonal détecte spécifiquement TRAM1L1 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour TRAM1L1 anticorps (Middle Region) (ABIN635623)

Antigène: TRAM1L1 (Translocation Associated Membrane Protein 1-Like 1 (TRAM1L1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRAM1L1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TRAM1L1 anticorps

Épitope: Middle Region

Specificité: TRAM1 L1 antibody was raised against the middle region of TRAM1 1

Purification: Affinity purified

Immunogène: TRAM1 L1 antibody was raised using the middle region of TRAM1 1 corresponding to a region with amino acids LWAIVFILGRLVTLIVSVLTVGFHLAGSQNRNPDALTGNVNVLAAKIAVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRAM1L1 Blocking Peptide, (ABIN5616754), is also available for use as a blocking control in assays to test for specificity of this TRAM1L1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAM0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRAM1L1

Antigène: TRAM1L1 (Translocation Associated Membrane Protein 1-Like 1 (TRAM1L1))

Autre désignation: TRAM1L1

Sujet: TRAM1L1 is stimulatory or required for the translocation of secretory proteins across the ER membrane.

Poids moléculaire: 42 kDa (MW of target protein)